PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG136300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 812aa    MW: 86864 Da    PI: 5.1508
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG136300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.34.8e-22104159156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe+lF+++++p++++r eL+++lgL+ rqVk+WFqNrR+++k
  Pavir.5NG136300.1.p 104 KKRYHRHTPQQIQELEALFKECPHPDEKQRGELSRRLGLDPRQVKFWFQNRRTQMK 159
                          678899***********************************************999 PP

2START183.71e-573225532206
                          HHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCS.CHHHHHHHHHCCCGGCT-TT-S.. CS
                START   2 laeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvd.mvlallveellddkeqWdetla.. 77 
                          la  a++elvk+a+ +ep+W  s       e++n +e+  +f +  +     + +ea+r+sg+v+ ++++ lve+l+d + +W+ ++   
  Pavir.5NG136300.1.p 322 LAINAMDELVKLAQIDEPLWLPSLngspnkEMLNFEEYAHTFLPCIGvkpmgYVSEASRESGLVIiDDSVALVETLMDER-RWSDMFScm 410
                          78899*******************999999999999999999998889**************997245679*********.********* PP

                          ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEE CS
                START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgil 153
                            ka+++e ++sg      gal +m+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d     ++     ++  vR+ +lpSg++
  Pavir.5NG136300.1.p 411 iaKATVIEEVTSGiagsrnGALLVMKAELQVLSPLVPiREVTFLRFCKQLAEGAWAVVDVSIDGLLRDQNsattsNAANVRCMRLPSGCV 500
                          **************************************************************85322222234568999*********** PP

                          EEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +++++ng +kvtwveh++++++++h+l+r+l++sgla+ga++w+a lqrqce+
  Pavir.5NG136300.1.p 501 MQDTPNGFCKVTWVEHTEYDEASVHQLYRPLLRSGLAFGARRWLAMLQRQCEC 553
                          ***************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.52E-2285161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-2489161IPR009057Homeodomain-like
PROSITE profilePS5007118.285101161IPR001356Homeobox domain
SMARTSM003894.8E-21102165IPR001356Homeobox domain
CDDcd000866.90E-20103161No hitNo description
PfamPF000461.5E-19104159IPR001356Homeobox domain
PROSITE patternPS000270136159IPR017970Homeobox, conserved site
PROSITE profilePS5084845.75312556IPR002913START domain
SuperFamilySSF559614.18E-30315553No hitNo description
CDDcd088751.72E-112316552No hitNo description
SMARTSM002343.3E-46321553IPR002913START domain
PfamPF018522.5E-50322553IPR002913START domain
SuperFamilySSF559611.65E-21573776No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MSFGSLFDGG AGGGSGGGMQ FPFSAGFSSS PGLSLGLDNN AAAGGGMGGG RALPGGPGAG  60
GGSGAARDAD AENDSRSGSD HLDAMSGGGE DEDDAEPGNP RKRKKRYHRH TPQQIQELEA  120
LFKECPHPDE KQRGELSRRL GLDPRQVKFW FQNRRTQMKT QLERHENALL KQENDKLRAE  180
NMTIREAMHS PMCGSCGSPA MLGEVSLEEQ HLCIENARLK DELNRVYALA TKFLGKPMSM  240
LAGPLMQPHL SSLPMPSSSL ELAIGDFRGL GSMPSATMPG SMGEFAGGVS SPLGTVITPA  300
RATGSAPLAM VRIDDRSMLL ELAINAMDEL VKLAQIDEPL WLPSLNGSPN KEMLNFEEYA  360
HTFLPCIGVK PMGYVSEASR ESGLVIIDDS VALVETLMDE RRWSDMFSCM IAKATVIEEV  420
TSGIAGSRNG ALLVMKAELQ VLSPLVPIRE VTFLRFCKQL AEGAWAVVDV SIDGLLRDQN  480
SATTSNAANV RCMRLPSGCV MQDTPNGFCK VTWVEHTEYD EASVHQLYRP LLRSGLAFGA  540
RRWLAMLQRQ CECLAILMSP DTVSANDSSV ITQEGKRSML KLARRMTENF CAGVSASSAR  600
EWSKLDGATG SIEEDVRVMA RKSVDEPGEP PGVVLSAATS VWVPVAPEKL FNFLRDEQLR  660
AEWDILSNGG PMQEMANIAK GQEHGNSVSL LRASAMSANQ SSMLILQETC TDASGSMVVY  720
APVDIPAMQL VMNGGDSTYV ALLPSGFAIL PDGPSATTGH KTGGSLLTVA FQILVNSQPT  780
AKLTVESVVT VNNLISCTIK KIKTALQCDA T*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199105PRKRKKR
2100104RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.166400.0stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632490.0BT063249.1 Zea mays full-length cDNA clone ZM_BFc0042P14 mRNA, complete cds.
GenBankBT0644530.0BT064453.1 Zea mays full-length cDNA clone ZM_BFc0170E20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968001.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like isoform X1
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLK3XEM70.0K3XEM7_SETIT; Uncharacterized protein
STRINGSi000344m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1